Quick Start Weight Loss Program: All For Only $100. ​​Call Now: 215-821-7336 for your FREE Consult
  • Weight Loss Blog

WakeUpSkinny Philadelphia Medical Weight Loss Diet  Management Program

  • Home
  • About Us
  • Weight Loss
    • Medical Weight Loss Info
    • Weight Loss Pills Appetite Suppressants Vitamin B12 Injections Philadelphia
    • Doctors Medical Weight Loss Programs Philadelphia
    • Prescription Weight Loss Pills
    • Medical Weight Loss Clinic
    • Weight Loss Programs
  • Weight Loss Tips
  • Case Studies
CONTACT US
  • Home
  • Medical Weight Loss
  • Archive from category "Medical Weight Loss"
  • (
  • Page 8
  • )
 

Category: Medical Weight Loss

How They Get Thin Fast with Medical Weight Loss Philadelphia

Friday, 19 May 2017 by Dr. Michael Kenny

fast weight loss in philadlephia diet pills doctor supervisedIn our Philadelphia medical weight loss center we try to provide the best FDA approved weight loss medications, appetite suppressant medications diet pills weight loss pills and of course we do use the vitamin B-12 injections and instruct you are patients in good solid nutritional plans and exercise plans to help you lose weight and achieve your health and wellness goals.

And every time I am talking with one of our patients I am always getting feedback as to what they are trying to do; either burn extra body fat, told their muscles up a bit or you may be trying to burn fat and build muscle at the same time. And of course I’m always getting requests from our patients for certain types of recipes, some patients might ask for extra smoothie recipes while others might be asking for more recipes on low carbohydrate recipes or just low-calorie recipes. For the past couple weeks everyone has been asking me for more smoothie recipes. It seems that our weight loss patients are looking for recipes that are quick and easy to make and going to provide them with lots of good healthy powerful nutrition. And also help satisfy their hunger and cravings.

So with that being said, today I am giving you some really great smoothie recipes loaded with vegetables and fruit that should provide your body with a tremendous amount of healthy nourishment and help satisfy your hunger and your tastebuds at the same time.

Now, please be aware that for  beverages in the smoothies I used different types of nut milks, and if you are allergic to nuts you definitely do not want to use these beverages you can use any other type of beverage to replace them. To make it nice and easy you can use water.

I am going to give you some on additional ingredients you can add to any of these smoothies. For extra protein you can use a low-carb low sugar type of protein powder such as our solutions for awesome fantastic wonderful protein powder meal replacement powder, hemp seeds, grass fed gelatin and way. For healthy fats you can use coconut oil, flax oil, coconut butter, avocados, Chia seeds, flax seeds, and extra nuts and seeds.

And here are some additional flavor boosters and super foods that you can add to the smoothies as well: Chia seeds, fresh ginger, hemp seeds, acai powder, cacao or cacao nibs, maca powder, ground flax seeds, spirulina, bee pollen, shredded coconut, cinnamon, vanilla extract, vanilla bean, chlorophyll and lucama powder.

Lots of these ingredients can be purchased at your local supermarket and especially at your local health food store.

Spinach Bomb

  • 3 cups of spinach
  • 2 cups of unsweetened almond milk
  • 1 small banana
  • Blend and enjoy.

Nutty Kale Smoothie

  • 3 cups of kale
  • 2 cups of unsweetened cashew milk
  • 1 cup of berries either fresh or frozen
  • Blend and enjoy.

The Not for Breakfast Only Smoothie

  • 3 cups of collard greens
  • 2 cups of unsweetened almond milk
  • 1 cup of mango chunks
  • Blend and enjoy.

Amanda Smoothie

  • 3 cups of lettuce
  • 1 cup of unsweetened almond milk
  • 1 cup of Kiwi
  • Blend and enjoy.

Peace and Harmony Smoothie

  • 3 cups of dandelion greens
  • 2 cups of iced green tea
  • 1 cup of papaya
  • Blend and enjoy.

Macy’s Smoothie

  • 1 cup of watercress
  • 2 cups of Kefir
  • 1 cup of are ready slices

The Skinny Smoothie

  • 2 cups of celery
  • 2 cups of unsweetened almond milk
  • 1 cup of fresh or frozen peaches
  • Blend and enjoy.

The Spa Smoothie

  • 2 cups of cucumbers
  • 2 cups of full fat unsweetened Greek yogurt preferably organic
  • 1 cup of BlackBerries fresh or frozen
  • Blend and enjoy.

So there you have it, some really great recipes that will help give your body a tremendous boost of good healthy nutrition, help satisfy your appetite and cravings and help improve your overall health and wellness. All in addition to helping you achieve your weight loss goals. If you, a family member, a friend, a coworker or loved one need help with losing weight I invite you to call us and schedule your free weight loss consultation. And please remember that in addition to helping weight loss we also provide additional services like Botox, fillers, and nutritional cleansing programs and programs designed to help improve energy and overall health and wellness. So call us now and schedule your free consultation call us at 215-821-7336

Medical Weight Loss Philadelphiaweight loss philadelphia
Read more
  • Published in diet doctors, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Weight Loss, weight loss philadelphia
No Comments

Burn Fat Fast with Medical Weight Loss in Philadelphia

Saturday, 15 April 2017 by Dr. Michael Kenny

medical weight loss in philadelphia weight loss diet doctors weiIn our Philadelphia medical weight loss program we use  high quality FDA approved weight loss pills, appetite suppressant medications and diet pills, vitamin B12 injection therapy, sensible nutrition meals plans and increased physical activity to help you lose weight and improve your overall health and wellness.

The weight loss medications are designed to help control your appetite, cravings and hunger and this should help you make the right food choices. Some people think that because the appetite suppressants really decrease their cravings that they do not need to eat. But you still must eat if you want to safely lose weight and keep it off.

Since the medications help reduce your appetite you should not have the urge to binge on bad food choices.But you must eat good healthy food. And in our weight loss program we spell out for you what you should be eating and what you should not be eating. We also give you ideas and recipes for meals that will help you lose weight and burn fat. Our goal is to help you develop good healthy lifestyle habits that will help you maintain your weight loss.

For more information on our medical weight loss program in Philadelphia just call us now and schedule your Free weight loss consultation. Call us at 215-821-7336 and we would be happy to answer your questions and schedule you for your free consultation.

In this post I am giving you 4 great smoothie recipes that our weight loss patients have enjoyed. The recipes are for a Chocolate Banana and Almond Butter Smoothie, a Banana and Strawberry Breakfast Smoothie, a Chocolate and Banana Smoothie and our Very Berry Green Smoothie.

Here are the recipes:

Chocolate Banana and Almond Butter Smoothie

  • Unsweetened almond milk, 1 cup
  • banana – 1 banana, Frozen if you like
  • Sugar free chocolate syrup – 1 tablespoon
  • almond butter – 1 tablespoon
  • ice – 1 Cup
  • Blend & Enjoy!

Banana and Strawberry Breakfast Smoothie:

  • strawberries – ½ cup of strawberries
  • banana – 1 banana
  • spinach – 1 Cup
  • unsweetened almond milk – ½ cup
  • vanilla extract – 1 teaspoon
  • Blend & Enjoy!

Chocolate and Banana Smoothie Ingredients:

Banana – 1 banana,  can be frozen if you like

  • almonds – 14 almonds
  • full-fat Greek yogurt – 1 Cup
  • cocoa powder – 1 tablespoon of cocoa powder
  • You can also add in:
  • Coconut flakes – 1 teaspoon
  • almond butter or peanut butter preferably organic – 1 teaspoon
  • 1/2 cup strawberries or cherries
  • fresh mint
  • Blend & Enjoy!

Very Berry Green Smoothie Ingredients:

  • Strawberries – 1/4 cup
  • raspberries – 1/4 cup
  • blueberries or blackberries – 1 quarter cup
  • 2 handfuls of spinach
  • about 1 cup of water
  • ice – 1 cup of ice
  • Blend & Enjoy!

I hope that you really enjoy these recipes. If you, a friend or loved one need help with losing weight and improving your health and wellness I invite you to call us and schedule a free weight loss consultation. Call us now at 215-821-7336 for your free weight loss consultation.

diet doctors in bucks countydiet doctors in philadelphiadiet pills in philadelphiamedical weight loss in philadelphiaMedical Weight Loss Medical Weight Loss in Philadelphia PAMedical Weight Loss Philadelphiaphiladelphia diet doctorsQsymiaSuprenza Xenical Contrave Phentermine and topiramate Qsymia Phentermineweight loss philadelphiaweight loss philadelphia and tagged affordable phentermine philadelphia doctorsweight loss pills in philadelphia weight loss pills philadelphia weight loss programs Philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Get Rid of Belly Fat Fast with Medical Weight Loss in Philadelphia

Friday, 07 April 2017 by Dr. Michael Kenny

medical weight loss in philadelphia weight loss diet doctors weiIn our Philadelphia medical weight loss program the number one question that I get is “Why people still have to eat even though the weight loss pills, appetite suppressant medications and diet pills doing a fantastic job of getting rid of people’s cravings and hunger?”

And the answer is that you still need to eat the right types of food to help you lose weight and burn fat safely.

And that is the reason why we spend time reviewing proper nutrition and why we post weight loss tips and recipes every week on this blog. And with that being said here are 5 great recipes to help you lose weight and burn fat. If you are new to our medical weight loss center and would like more information just call us and schedule your free weight loss consultation. Call us at 215-821-7336 for your free consultation.

The recipes I am giving you today are: Pepperoni Cheese Baskets, Parmesan Chicken Balls, Chocolate Macadamia Ice Cream, Chocolate Fluff and Fettuccine Alfredo.

Pepperoni Cheese Baskets*

  • Ingredients:
  • pepperoni – 3 ounces sliced into four
  • full fat cream cheese – 4 else’s
  • sour cream – 1/4 caught
  • garlic – 2 cloves of grated garlic
  • red bell pepper – 1 ounce of grated red bell pepper
  • Tabasco sauce – just a dash
  • salt and pepper to taste

Mix your full fat cream cheese, sour cream, grated garlic, red bell pepper, Tabasco sauce and salt-and-pepper until it’s combined in nicely. Take a muffin hand that will allow you to make 4 muffins and line the muffin cups with cling wrap. Next place a slice of pepperoni into the bottom each of the muffin cups and evenly divide your cream cheese and sour cream batter into the 4 muffin cups. After that just placed them in refrigerator for at least 1 hour. After about 1 hour they should be firm enough to eat but I like to leave them in there a bit longer so that the flavors really intensified. When you are ready to eat them just remove them from the muffin cups and you can enjoy them with some delicious veggies. Each muffin has approximately 240 calories and 3 grams of carbohydrates.

Parmesan Chicken Balls*

  • Ingredients:
  • chicken breast – 3 ounces of ground cooked chicken breast
  • Parmesan cheese – 1 ounce grated
  • cheddar cheese – 1 ounce shredded
  • full fat cream cheese – 10 ounces
  • sour cream – 3 tablespoons
  • chili sauce – 1/2 teaspoon
  • green onion – 1 green onion minced
  • cilantro – 2 tablespoons of finely chopped cilantro
  • salt and pepper to taste

Start by putting the sour cream and cream cheese into a bowl and mixing them until they are smooth. After that start in the chili sauce, chicken, Parmesan cheese, cheddar cheese and salt-and-pepper. Kathy then take a plate and mixed together the cilantro and green onion. Now divide your chicken mixture into 12 equal portions and put them onto the herbs. Gently roll each of the first to form balls and then place them in the refrigerator and give them time to set. This is a really fantastic recipe and has only 124 calories and 1 gram of carbohydrate.

Chocolate Macadamia Ice Cream*

  • Ingredients:
  • Heavy Whipping Cream – 1 Cup
  • Full Fat Cream Cheese – 1 Cup
  • unsweetened cocoa powder – 2 tablespoons
  • macadamia nut butter – 2 tablespoons
  • xanthan gum – 1 teaspoon
  • liquid Stevia extract – 1/4 teaspoon or more depending upon your taste
  • macadamia nuts – 1 ounce of chopped academia nuts.

We begin this great recipe by placing all the ingredients, except for the nuts, into a food processor or blender and mix until everything is nice and creamy smooth. After that if you have an ice cream maker just charted the ice cream maker or if you do not have an ice cream maker you could just place it in the freezer. Just make sure that it’s in a freezer proof container. If you do not have an ice cream maker you will have to stir this about every normal 30 minutes or so to make sure that it does not crystallize. Let it freeze until you have the ice cream texture that you like. I usually like to take mine out of the freezer for about a good 15 minutes before serving it. When you are ready you can just sprinkle the chopped macadamia nuts over top of the ice cream. This recipe makes six servings. Each serving has approximately 290 calories and 5 grams of carbohydrates.

Chocolate Fluff*

  • Ingredients:
  • Ingredients:
  • heavy cream – 1/2 cup of chilled heavy cream
  • cocoa powder – 1 tablespoon of cocoa powder
  • chocolate liquid Stevia – 5 drops of chocolate liquid Stevia
  • French vanilla liquid Stevia – 5 drops of French vanilla liquid Stevia

This is a super easy recipe to make all that you need is to use an electric mixer and just with all of the ingredients together until it is stiff. And if there you have it, two servings of the delicious low-carb and no sugar chocolate whip.

This recipe makes two servings each of them having about 200 calories, 3 grams of carbohydrates and 2 grams of protein.

Fettuccine Alfredo*

  • Ingredients:
  • fettuccine style tofu shirataki noodles – 1 packet
  • cream cheese with chives and onions – 1 tablespoon
  • butter – 1 tablespoon
  • grated Romano or Parmesan cheese – 2 tablespoons

First we must cook our shiitake noodles, just follow the package directions to cook them properly.(I usually cook my shiitake noodles by first draining and rinsing them. Then I put them in the microwave bowl and microwave them for about 2 minutes and then I drain them. Next I microwave them one more time for about a minute or so and then I trained them one more time.) After you have cooked your noodles place them in a bowl and mix in the cream cheese with chive and onions in the butter and stir everything until they melt and for a very nice smooth sauce. After that to sprinkle with 1 tablespoon of your cheese and stir this end. And you can use the other 1 tablespoon of grated cheese to sprinkle over top. Now all you have to do is eat and enjoy.

I hope you enjoy these recipes and to schedule your free weight loss consultation call us now at 215-821-7336.

affordable phentermine philadelphia doctorsdiet pills in philadelphiamedical weight loss in philadelphiaphiladelphia diet doctorsQsymiaSuprenza Xenical Contrave Phentermine and topiramate Qsymia Phentermineweight loss philadlephiaweight loss pills in philadlephiaweight loss pills philadelphiaweight loss programs Philadelphia
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, weight loss philadelphia
No Comments

Lose Your Belly Fast With Medical Weight Loss in Philadelphia

Monday, 27 March 2017 by Dr. Michael Kenny

medical weight loss in philadelphia weight loss pills diet pills

In our Philadelphia Medical Weight Loss Program most patients tell us that they aren’t really hungry because the weight loss pills, appetite suppressant medications and diet pills do a great job of controlling hunger and cravings. But you still need to eat if you want to lose weight safely.  So here are 4 great recipes that have helped our Philadelphia Medical Weight Loss patients lose weight fast without being hungry. If you would like more information on our weight loss system call and schedule your free consultation with one of our Doctors or Physician Assistants. Call 215-821-7336 and schedule your free consultation now.

Asian Noodles Low Carb Style

  • shiitake noodles – 1 packet
  • coconut oil – 1 tablespoon
  • natural peanut butter – 1 tablespoon
  • chicken broth – 1 tablespoon
  • dark sesame oil – ½ teaspoon grated ginger root – ½ teaspoon
  • liquid Stevia – 1 drop
  • garlic – 1 clove
  • soy sauce – 1 teaspoon
  • scallion – 1 or more

Let’s start by a pouring your noodles into a strainer and rinse them thoroughly. Next drain them and put them in a bowl that is microwavable safe and microwave them for approximately 2 minutes. After that drain them one more time and then microwave than for 1 – 2 minutes. After that place all of the ingredients into the bowl and blend it all nicely together.

Vanilla Cheesecake Snacks

  • This recipe makes 6 servings
  • softened cream cheese – 8 ounces
  • heavy whipping cream – ½ cup
  • 3 – 4 tablespoons of vanilla extract you can use more extract if needed
  • eggs – 3 whole eggs
  • sugar substitute sweetener to taste

Start by a mixing the heavy cream and cream cheese until it’s nice and smooth and then add the remaining of the ingredients. Take greased ramekins and pour the batter into them and place them on a cooking pan and let them bake at 350°F for approximately the 30 – 40 minutes. Just cook them for as long as it takes until you can place a toothpick into the cake and when you remove it it is clean. After that just set them aside and let them cool down. Just make sure that you refrigerate them before serving them.

Cocoa Nutty Keto Pudding

  • Sour cream – ½ cup preferably organic
  • unsweetened cocoa powder – 2 teaspoons
  • liquid Stevia drops – approximately 8 drops
  • almond extract – to taste, I usually like 1 teaspoon or so

This recipe makes one serving and it’s so simple to make. All that you have to do is place all of the ingredients into a ball and stir until everything is mixed together nicely.

Keto Salty Caramel Coffee

  • 1 cup of brewed coffee
  • heavy whipping cream – 2 ounces
  • sugar-free salty caramel syrup – 1 tablespoon

This recipe makes one awesome cup of coffee. Just make your coffee like you normally would and stir in the sugar free caramel syrup and heavy cream. Just be sure to mix in everything nicely.

Scrambled Eggs and Cream

  • 2 large eggs
  • 3 tablespoons of heavy cream
  • 2 table spoons of butter

Stir together the eggs and the heavy cream. Place a pan over medium heat and melt the butter to grease the pan. Next pour in the eggs and heavy cream mixture and cook like you normally would scrambled eggs.

If you need help losing weight call us now at 215-821-7336 and schedule your free weight loss consultation now.

medical weight loss in philadelphiaphilly diet drphysician supervised weight loss in philadelphiaweigh tloss doctors in philadelphiaweight loss programs Philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Blast Away Pounds and Inches with these Smoothie Recipes by Medical Weight Loss in Philadelphia

Wednesday, 15 March 2017 by Dr. Michael Kenny
medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

Our Philadelphia medical weight loss program is a totally comprehensive program where we use FDA approved weight loss pills, appetite suppressant medications (diet pills)  to help people lose weight and improve their overall health and wellness.

We use high quality appetite suppressant medications, vitamin injection Therapies and nutrition and the exercise plans to help you reach your target body weight with a plan that  you are actually be able to follow the real world.

If you would like more information on our weight loss program invite you call and schedule your free weight loss consultation. Call us at 215-821-7336 for a free weight loss consultation.

In our weight loss program we have helped people lose anywhere from 20 pounds to 100 plus pounds. In fact, I just finished a consultation with one of our Superstar weight loss patients who has lost 110 pounds so far.

So if you would like to join our weight loss team call us at 215-821-7336 and schedule your free weight loss consultation.

In this article I am giving you 4 smoothie recipes that really helped Erin lose her weight. They are the recipes for our Berry Nutty Smoothie, Green Apple Avocado Smoothie, Cocoa Berry Nutty Smoothie and our Pumpkin Berry Smoothie.

Berry Nutty Smoothie

  • raspberries  – 1 cup fresh or frozen
  • ½ lime – peeled
  • almonds – 1 handful
  • Full fat plain greek yogurt – 1 Tbsp
  • Swiss chard -1 handful
  • 1 scoop WakeUpSkinny Protein Powder
  • Blend and enjoy!

Green Apple Avocado Smoothie

  • 1 green apple
  • ½ avocado
  • spinach – 1 cup
  • almond milk – 1 cup unsweetened
  • goji berries – 2 Tbsps fresh or frozen
  • 1 scoop WakeUpSkinny Protein Powder
  • Blend and enjoy!

Cocoa Berry Nutty Smoothie

  • strawberries – 1 cup fresh or frozen
  • almond milk – 1 cup unsweetened
  • 1/2 cup broccoli
  • Raw cocoa beans 3-4
  • 1 scoop WakeUpSkinny Protein Powder
  • Blend and enjoy!

Pumpkin Berry Smoothie

  • blackberries – 1 cup fresh or frozen
  • pumpkin seeds – 1 Tbsp
  • chia seeds – 1 tsp
  • coconut milk – 1 cup
  • 1 scoop WakeUpSkinny Protein Powder
  • Blend and enjoy!

I hope you enjoyed a smoothie recipes. If you, a friend or loved one would like to schedule your free weight loss consultation just call us at 215-821-7336.

medical weight loss in philadelphiaphilly diet doctorsweight loss in philadlephiaweight loss pills in philadelphia
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia
No Comments

Fat Burning Comfort Food for Your Snow Storm Snowed in Party by Medical Weight Loss in Philadelphia

Monday, 13 March 2017 by Dr. Michael Kenny
medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

Can you believe it’s March 13th and tonight it’s suppose to snow 12 to 18 inches. So for the next day or so we will probably be snowed in. And we have decided to get together with our siblings for a Snowed In Family Party. In this article I will list 2 comfort recipes we will be making and also a list of some foods that should be purchased before a storm. If you would like more information on our medical weight loss program call us to schedule your free medical weight loss consultation at 215-821-7336.

Here are a few recipes we will be enjoying:

 

Low Carb Homemade Whipped Cream: 4 servings

  • Ingredients:
  • (35%) heavy whipping cream – 1 cup
  • vanilla extract – 1 teaspoon
  • himalayan salt – 1 small pinch
  • 1-2 packets of stevia or 1-2 drops of liquid stevia.
  • Combine everything in a bowl and use a small hand mixer to whip the cream.

Low Carb Hot Cocoa

  • 1 Serving for a large mug
  • Ingredients:
  • 1/4 cup of heavy cream, or almond or coconut milk – cream – ¼ cup
  • cocoa powder – 1 tablespoon
  • stevia – 1-2 packets or 1-2 drops of liquid stevia
  • cinnamon – just a pinch
  • vanilla extract – 1 tablespoon
  • himalayan salt – 1 small pinch
  • 1 cup of boiling hot water
  • Carefully mix all of the ingredients into a mug and stir until it’s all mixed together.
  • You can top this with the homemade whipped cream you made.

In case the power goes out we are stocking up on:

  • Bottled water
  • Tuna in cans or packs
  • Sardines
  • Fresh fruit
  • Canned beans
  • Canned meats
  • Bread – preferably gluten free
  • Wakeupskinny protein powder
  • Can opener – a good old fashioned manual one that is not electric
  • Paper plates
  • Paper cups
  • Plastic utensils
  • Paper towels
  • Toilet paper
  • Wipes (wet ones)
  • Hand sanitizer
  • Heavy duty trash bags
  • Extra blankets
  • Flash lights
  • Batteries for the flashlights
  • Battery powered lanterns
  • Being able to communicate with people is very important and that is why we are also making sure that our mobile phones are totally charged and have a few portable chargers for our phones.
  • Flash lights
  • Batteries for the flashlights

I hope you found this article informational. I know it’s different from my usual posts but I felt it was necessary to share.

If you or a friend need help with losing weight I invite you to call and schedule your free medical weight loss consultation. Call us now at 215-821-7336 for your free weight loss consultation.

"Medical Weight Loss clinic Philadelphia"Appetite Suppressantsdiet pills Philadelphiadoctors prescribe phentermine Philadelphiafoods to buy before a snow stormfoods to buy before a stormmedical weight loss doctors Philadelphiamedical weight loss in philadelphiaweight loss pills in philadelphiaweight loss programs Philadelphia
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Why You Can’t Lose Weight No Matter How Hard You Try? The Real Reason by Philly Diet Dr

Saturday, 11 March 2017 by Dr. Michael Kenny
medical weight loss in philadelphia diet doctors weight loss pills appetite suppressant medications phentermine in philadelphia

medical weight loss in philadelphia diet doctors weight loss pills appetite suppressant medications phentermine in philadelphia

If you have been trying to lose weight and no matter what you do you just cannot seem to lose any pounds or inches then this article is a definite must read for you.

In today’s world most of the people are just like you. Everyone is on a diet, everyone is doing low-carb or high fat and no carbohydrates or they are doing a low-calorie diet. And then we have other people that are doing nothing but smoothies and drinking juice all day long. Other people just eat fruit. And then we have people that are vegetarians but they only eat a small amount of vegetables and most of what they eat are starchy carbohydrates like pizza, pasta and rice. In fact most of us eat more bad starchy carbohydrates than any other type of food.

Most of us are eating bread, pasta, rice and potato chips and crackers all day long. Almost all of these foods are not even food. They are products made by man and there are man-made manufactured foods. They are not natural real food. They have nothing but calories and sugar and they provide no nutritional value to you.

Instead of eating all of those potato chips, pasta, bread and pizza eat some carrots, celery, lettuce, cucumber, bell peppers and broccoli.

And the problem is the so-called nutrition experts, the authorities told us along time ago that we should be eating lots of grains. But the problem is when they made this statement and said that this is the way to true health and wellness they really did not do enough research to look into the type of effect it has on our body’s chemistry. Eating nothing but bad starchy carbohydrate type of foods does nothing but increase your blood sugar level. And when your body has excess sugar floating around in your bloodstream your insulin levels go very very high and the only thing that the body can do is to store this excessive amount of sugar ias body fat. And the reason why it does this is because the sugar is very dangerous, It causes a tremendous amount of damage to the various organs and systems of your body.

And if your hormones are not in the proper balance in your body you are just going to be sick and overweight. And honestly it’s not your fault. You were just following the guidelines that have been set forth by the so-called experts in the field of health wellness and nutrition.

So again I want to tell you that if you have been doing everything that you have been told to do and you’re not losing weight it’s not your fault. You have just been given wrong information and wrong instructions and directions. Now in order to truly be healthy you have to get your  hormonal levels under control. And one of the easiest things that you can do is to control this by the foods that you are eating

One of the most important hormones in your body that will have an effect on whether you are fit and trim or overweight and fat and sick is insulin. Insulin is one of the most important hormones in your body. When your insulin levels are excessively high they put you into fat storage mode. Meaning everything that you eat is going to be stored his body fat.

This means that in order to stay fit trim and healthy you have to keep your insulin levels at a relatively normal level throughout the course of your day. And the way that you do this is to control the amount of foods that you eat that turn into sugar. And as you may have guessed the type of foods that turn into sugar are your bad starchy carbohydrates that are processed and man-made such as your bread, pasta, rice, pretzels, potato chips and all those other yummy snacks that we love to snack on.

Now of course I am a firm believer in eating good healthy food and that includes lots of vegetables, every color of vegetable and every type. Vegetables are a carbohydrate but they are nutritious healthy carbohydrates that are loaded with good nutrition and healthy fiber that will help to keep us healthy. And if we are healthy most of the time our weight will be controlled.

So for me the perfect diet would consist of lots of vegetables, a modest amount of good healthy protein, a small amount of good healthy fats and a little bit of fruit and your other starchy carbohydrates.

So you see that I am not totally against your starchy carbohydrates like bread and pasta it’s just that I believe that we should be eating much less of these types of food than we are eating in today’s society.

A few paragraphs up, I told you that hormones control your health wellness and the amount of weight fat etc. that you have on your body. And this is another key point because as we get older our amounts of hormones decrease in quantity over the period of time.

And this is the reason why most of us hit a certain age usually somewhere in the mid 30s and we start gaining weight every year. First we may start out just by gaining a couple pounds a year and then that increases to as much as 5 pounds or 10 pounds a year. Then we finally wake up and realize that we are 60 or 70 pounds overweight and we need to do something about it.

You see you when we were younger and we had an abundance of hormones; they helped burn that extra sugar out of our body. They helped keep the insulin at lower levels. But as we get older and our body’s natural hormones level decrease our body is not able to burn up that extra sugar like it did when we were younger.

This is why you are now gaining weight even though you are eating the same type of food, following the same diet plan and even exercising the same way as you did when you were much younger.

Losing weight and being fit and healthy just comes down to eating the right types of food in the proper portion sizes.

And please do not forget that calories do matter.

We have lots of people coming to us from other medical weight loss centers and they were told to eat a high-protein low-carb diet and that they could eat as much meat protein and cheese as they want.

But this is not healthy and it’s not true. Your body can only handle so much protein and process it properly. Excessive amounts of protein do you turn into sugar just like your bread and pasta.

I know some of you were probably reading this article and just shaking your heads in disbelief because if you would have been given this information long ago you would not be overweight now.

So now that you have the right information let’s get you on the right path. Let’s start developing healthy lifestyle habits. Little changes over the course of time that are going to add up to lots of pounds lost and a healthier and more fit you.

Trying to do all of these changes at once can be a little bit overwhelming so I advise you to start out slowly.

If your hormonal system is totally out of balance it’s always a good idea to work with a Weight Loss center. Especially one like ours where we have medical physicians that can assist you with the use of prescription weight-loss medication appetite suppressant medication.

The government has realized that obesity is a major health crisis in this country now. And it’s my belief that that is why the FDA has approved quite a few new weight-loss medications over the past several years.

In the past most weight loss pills were only meant to be taken for a short period of time but now we have newer weight-loss medications that are approved by the FDA for long-term usage.

So while some people may only need to be on the weight-loss medications for short period of time others may need to take them for the rest of their life because of hormonal issues. And that is why the pharmaceutical companies have spent billions of dollars in research and development of these drugs to help with this major health crisis. And that is why the FDA is now approving these weight-loss medications for long-term use.

Now there are certain qualifiers that have to be met in order for the physician to prescribe these medications for you. Some of them are your BMI, your height, your weight, your waist circumference, your pant size, your dress size, if you or family member have the following illnesses: diabetes, heart attack, stroke, cancer, high blood pressure, hypertension, hypothyroidism and sleep apnea – difficulty sleeping

The weight-loss medications to a great job of controlling the appetite and hopefully limiting your cravings but you still have to eat the right types of food to and that is why we spend quite a bit of time reviewing good healthy eating nutrition plans with our weight-loss patients. And getting some exercise – physical activity is also highly recommended.

If you need help with losing weight or just trying to improve your health and wellness give us a call and schedule a free weight loss consultation. Call 215-821-7336 and we will happy to schedule your free consultation.

adipexinphiladelphiabelviqinphiladeldphiabestphillydietdoctorsContraveinphiladelphiadietpillsinphiladelphiainexpensiveweightlosspillsinphiladelphiamedicallysupervisedweightlossinphiladelphiamedicalweightlossinphiladelphiaPhendimetrazineinphiladelphiaphentermineinphiladlephiaphillydietdoctorsqsymiainphiladelphiasafeweightlosinphiladelphiaSaxendainphiladelphiaTopamaxinphiladelphiaTopitamateinphiladelphiaweightlossinphiladelphiaweightlosspillsinphiladelphiaXenicalinphiladelphia
Read more
  • Published in diet doctors, Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Flatten Your Belly Fast With These 4 Smoothie Recipes by Medical Weight Loss in Philadelphia

Sunday, 26 February 2017 by Dr. Michael Kenny

medical weight loss in philadelphia weight loss pills diet pillsToday I have to take the time and thank all of the patients in our Philadelphia medical weight loss program and our Bucks County weight loss program who have referred all of their family members, friends and coworkers to our program so that we may help all of them lose weight and improve their health and wellness. THANK YOU!!!!!

This past week has been one of our busiest weeks ever especially during this time of year. And I have to attributed to our wonderful patients and the few days of sunshine and high temperatures into the 70s.

Because of the unusually hot weather lots of our patients were wearing their warm weather clothing and showing off their new slim and trim sexy bodies! And when everyone asked them what they were doing they were kind enough to give our weight loss program some of the credit for their success and gave everyone are contact information and told him to call us for the free medical what was consultation. I have to say that at least 70% or more of our new patients this week came from referrals from our weight loss patients. So for this I give all of you my heartfelt thanks.

One of our new patients, Tamika, was so excited to join our program this week. She told me that she has been exercising with one of her coworkers, Brenda(who has been one of our weight loss patients) and while Brenda was losing lots of weight, she herself only lost a few pounds. So she finally asked Brenda if she was doing anything else to help her lose all of that weight and Brenda told her about our weight loss program. And our weight loss program was the only thing that she was doing differently. So again thank you Brenda and everyone else who has referred people into our weight loss program.

If you would like more information on her medical weight loss program I invite you to call us and schedule your free consultation. Call us at 215-821-7336 and we will be happy to schedule you for your free consultation. Our weight loss program includes FDA approved medical weight loss pills and appetite suppressant medications, vitamin shots, instructions on our rapid weight loss diet plan and exercise plan.

In this article I am giving you 4 more delicious smoothie recipes to help blast away blast away fat. The recipes are for Apple Berry Dream Smoothie, Strawberry Banana Smoothie, Berries Apple Smoothie and my favorite Doc’s Favorite Smoothie.

Apple Berry Dream Smoothie

  • Spring mix greens – 1 handful
  • spinach – 2 handfuls
  • water – 2 cups of water
  • frozen blueberries – 1 cup
  • Apple – one Apple with the court in seeds removed – cut into quarters
  • banana – 1
  • Stevia – 1 packet Stevia
  • ground flax seeds – 2 tablespoons
  • 1 scoop Solutions 4 protein powder
  • Place all of your greens into the blender and blend until it becomes liquefied and then stop the blender and add all of the of the ingredients then place the lid back on your blender and then continue blending until everything is creamy smooth.

Strawberry Banana Smoothie

  • Spring mix screens – 3 handfuls
  • 1 scoop Solutions 4 protein powder
  • water – 2 cups of water
  • apples – all too small apples with the core and seeds removed and cut into quarters
  • banana – 1 small banana
  • frozen strawberries – 1 cup
  • Stevia – 2 packets, you can add more if needed
  • flaxseeds – 2 tablespoons of ground flax seeds
  • Combine all of your vegetables into the blender and blend until it becomes liquid than stop the blender add the rest of the ingredients, placed the lid back on top of your blender and blend until it’s creamy smooth.

Berries and Apple Smoothie

  • Spinach – 3 handfuls of spinach
  • water – 2 cups
  • Apple – 1 small apple cord seated and sliced into quarters
  • blackberries – 1/2 cup of BlackBerries
  • blueberries – 1/2 cup of blueberries
  • ground flaxseed – 2 tablespoons
  • 1 scoop Solutions 4 protein powder
  • Stevia – 1 – 2 packets or more if needed
  • First blend all of your greens and then add the rest of the ingredients and blend until you have a deliciously creamy smoothie.

Doc’s Favorite Smoothie

  • Spinach – 2 handfuls
  • Kale – 2 handfuls
  • frozen peaches – 1 cup
  • banana – 1 small banana
  • water – 1-2 cups
  • 1 scoop Solutions 4 protein powder
  • ground flax seeds – 2 tablespoons
  • Stevia – 2 packets or more depending upon your taste preferences
  • combine all of the vegetables into the blender and blend and when this is liquefied add the rest of the ingredients cover your blender and continue blending until everything is nice and smooth.

I hope you enjoy these recipes. Remember for more information on her weight loss program just call us at 215-821-7336 and schedule your free weight loss consultation.

medical weight loss in philadelphiaMedical Weight Loss Philadelphiaphiladelphia weight lossphiladelphia weight loss doctors
Read more
  • Published in diet doctors, Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia
No Comments

Blast Fat Fast with These 5 Hot Bod Recipes

Thursday, 23 February 2017 by Dr. Michael Kenny

 

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

Losing weight in our program is so much more than just the best weight loss pills and appetite suppressant medications.

In our Philadelphia medical weight loss program and our Bucks County medical weight loss program a powerful combination of FDA approved weight loss medications, vitamin injections therapy and a healthy meal plan has helped many people lose weight and achieved her health and wellness goals.

Our program goes so far beyond this by teaching you how to eat properly and help to exercise properly to achieve your goals. We do this to empower you with all of the information that you need to lose weight and maintain your weight loss without having to take some type of weight loss medication for the rest of your life.

That’s why we put so much emphasis on healthy eating habits and simple exercise plans the for most people just is walking. That’s why we are constantly updating this blog with healthy recipes and meal plans each and every week.

So even though you may not have to take medication for the rest of your life you can always come back to this blog as a source of information for great recipes to help you maintain your weight loss and even for new information and studies that are constantly being done for weight loss, health and wellness

So with all that being said here are 5 great smoothie recipes that are loaded with great nutrition and will help your tummy and eliminate your cravings and hunger.

The Banana Veggie Smoothie Bomb

  • Spinach – 1 handful
  • kale – 1 handful
  • broccoli – 1 handful
  • banana – 1 small bananas
  • frozen blackberries – 1 cup
  • ice – 1 cup
  • one scoop a wakeupskinny protein powder
  • First blend the handful of broccoli, then add the spinach and kale and blend once again and then add your fruit and wakeupskinny protein powder. After that add the cup of ice and blend everything thoroughly.

Ashley’s Smoothie Recipe

  • 1 scoop a wakeupskinny protein powder
  • 1 handful spinach
  • 1 handful of kale
  • 1 handful of mixed greens
  • 1 banana
  • 1/2 cup of unsweetened almond milk
  • 1/2 cup of Greek yogurt
  • 1/2 cup of ice
  • First add your vegetables to the blender and blend and then add the fruit, unsweetened almond milk and yogurt and blend once again and after that add everything else and blend until it’s frosty creamy smooth. If you like this a bit sweeter or you can add 1 – 2 packet of Stevia.

Creamy Avocado Banana Smoothie

  • 1 scoop a wakeupskinny protein powder
  • 1 handful of kale
  • 1 handful of broccoli florets
  • 1 cup of Greek yogurt
  • 1/2 of a small avocado peeled
  • 1 banana
  • 1/2 cup of ice
  • Blend your kale, broccoli florets and avocado and then add the fruit, protein powder and the ice and blend until it’s nice and frosty creamy smooth.

Minty Apple Ginger Smoothie

  • one scoop a wakeupskinny protein powder
  • 2 handfuls of kale
  • 2 small apples – remove the core and the seeds
  • 1/4-inch piece of fresh ginger graded
  • 1/4 cup of fresh mint leaves chopped
  • combine all the ingredients into the blender and enjoy. If needed you can add 1 – 2 packet Stevia to make this a little bit more sweet.

Morning Breakfast Smoothie

  • 1 scoop a wakeupskinny protein powder
  • 1 handful of spinach
  • 1 handful of kale
  • 1 orange – peeled and seeded
  • 1 pair – cored and seeded
  • 1/4 – 1/2 cup of full fat Greek yogurt
  • 1 tablespoon of ground flax or Chia seeds
  • Combine everything into a blender and enjoy.

I hope you enjoy the smoothies as much as I do. They have been very helpful maintaining my weight loss over these past few years.

If you or someone you know needs help losing weight or improving overall health and wellness I invite you to call and schedule your free weight loss consultation. For your free weight loss consultation call us at 215-821-7336.

For maximum health and wellness when you are making the smoothies make sure that you are having at least 1 – 2 handfuls of vegetables, preferably green vegetables.

"Philadelphia Diet Doctor""Weight Loss Doctors in Philadelphia"diet pills Philadelphiamedical weight loss doctors Philadelphiamedical weight loss in philadelphiaweight loss in philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Drop Pounds Fast With These 4 Smoothie Recipes by Medical Weight Loss in Philadelphia

Monday, 20 February 2017 by Dr. Michael Kenny

medical weight loss in philadelphia weight loss pills diet pillsIn our Philadelphia medical most program we know that now is the time that everyone starts getting ready for those summer days at the beach. And this means that most of us are trying to lose weight and drop those pounds and inches so that we look good and feel good in our bathing suits.

That’s why in this article I am going to give you four great smoothie recipes that will help you lose weight fast. When you combine these smoothies with everything that we give you in our medical weight loss program (proper rapid weight loss diet plan, exercise plan and FDA approved medical weight loss pills and appetite suppressant medications and our vitamin shots) you should be ready for the beach this summer.

If you would like more information on our medical weight loss program or even better schedule your free weight loss consultation call us at 215-821-7336 and our friendly staff would be happy to schedule you.

Today I’m going to give you some great recipes and they are for a creamy chocolate smoothie, a tropical paradise movie, a green monster smoothie and an apple a day smoothie.

So here are the recipe, Enjoy!!

Creamy Chocolate Smoothie

  • unsweetened almond milk – 1 cup
  • banana – 1 frozen banana
  • small avocado – one half of a small avocado peeled and pitted
  • honey – 1 tablespoon
  • unsweetened cocoa powder – 1 tablespoon
  • Combine the unsweetened almond milk, frozen banana, half of a small avocado, honey and unsweetened cocoa powder in a blender and blend until it’s creamy smooth. This recipe makes one smoothie.

Tropical Paradise Smoothie

  • one small orange – peeled with the seas removed
  • one small banana
  • flaked coconut – 2 tablespoons
  • 1/2 cup of unsweetened yogurt
  • 1/4 cup of ice cubes
  • optional – 1/4 cup of pineapple chunks
  • Combine everything into a blender and enjoy. This recipe makes 1 – 2 servings.

Green Monster Smoothie

  • Seedless green grapes – 1 cup
  • Kiwi – 1 small Kiwi peeled
  • 1/2 avocado – pitted and peeled
  • combine the seedless grapes, kiwi and half avocado into a blender and blend until it’s creamy smooth. This recipe makes one large serving.

An Apple a Day Smoothie

  • 1 Apple – preferably a Granny Smith apple cut into quarters and seeded
  • 1 cup of baby spinach
  • 1/2 cup of avocado – pitted and peeled
  • almond butter – 1 teaspoon
  • grated fresh ginger – 1/2 teaspoon
  • 1/2 – 1 cup of ice cubes
  • Combine your apple, baby spinach, avocado, almond butter and ginger into a blender and blend until it’s creamy smooth, then enjoy. This recipe makes one large serving.

So there you have it four fantastic smoothie recipes that will satisfy your taste buds, help control your appetite and cravings and help you lose weight safely.

If you, a friend or loved one would like help in losing weight I invite you to call us now and schedule a free weight loss consultation. Call us now at 215-821-7336.

medical weight loss in philadelphiaphiladelphia weight loss doctors
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments
  • 5
  • 6
  • 7
  • 8
  • 9
  • 10
  • 11

Wake Up Skinny

Phone Number

(215) 821-7336

Philadelphia Location

7439 Frankford Ave.
Philadelphia, PA 19136

Bucks County Location

1201 Buck Rd.
Suite 203
Feasterville, PA 19053

Lehigh County Location

163 N. Commerce Way
Bethlehem, PA 18017
TOP