Quick Start Weight Loss Program: All For Only $100. ​​Call Now: 215-821-7336 for your FREE Consult
  • Weight Loss Blog

WakeUpSkinny Philadelphia Medical Weight Loss Diet  Management Program

  • Home
  • About Us
  • Weight Loss
    • Medical Weight Loss Info
    • Weight Loss Pills Appetite Suppressants Vitamin B12 Injections Philadelphia
    • Doctors Medical Weight Loss Programs Philadelphia
    • Prescription Weight Loss Pills
    • Medical Weight Loss Clinic
    • Weight Loss Programs
  • Weight Loss Tips
  • Case Studies
CONTACT US
  • Home
  • Weight Loss
  • Archive from category "Weight Loss"
  • (
  • Page 6
  • )
 

Category: Weight Loss

Why You Can’t Lose Weight No Matter How Hard You Try? The Real Reason by Philly Diet Dr

Saturday, 11 March 2017 by Dr. Michael Kenny
medical weight loss in philadelphia diet doctors weight loss pills appetite suppressant medications phentermine in philadelphia

medical weight loss in philadelphia diet doctors weight loss pills appetite suppressant medications phentermine in philadelphia

If you have been trying to lose weight and no matter what you do you just cannot seem to lose any pounds or inches then this article is a definite must read for you.

In today’s world most of the people are just like you. Everyone is on a diet, everyone is doing low-carb or high fat and no carbohydrates or they are doing a low-calorie diet. And then we have other people that are doing nothing but smoothies and drinking juice all day long. Other people just eat fruit. And then we have people that are vegetarians but they only eat a small amount of vegetables and most of what they eat are starchy carbohydrates like pizza, pasta and rice. In fact most of us eat more bad starchy carbohydrates than any other type of food.

Most of us are eating bread, pasta, rice and potato chips and crackers all day long. Almost all of these foods are not even food. They are products made by man and there are man-made manufactured foods. They are not natural real food. They have nothing but calories and sugar and they provide no nutritional value to you.

Instead of eating all of those potato chips, pasta, bread and pizza eat some carrots, celery, lettuce, cucumber, bell peppers and broccoli.

And the problem is the so-called nutrition experts, the authorities told us along time ago that we should be eating lots of grains. But the problem is when they made this statement and said that this is the way to true health and wellness they really did not do enough research to look into the type of effect it has on our body’s chemistry. Eating nothing but bad starchy carbohydrate type of foods does nothing but increase your blood sugar level. And when your body has excess sugar floating around in your bloodstream your insulin levels go very very high and the only thing that the body can do is to store this excessive amount of sugar ias body fat. And the reason why it does this is because the sugar is very dangerous, It causes a tremendous amount of damage to the various organs and systems of your body.

And if your hormones are not in the proper balance in your body you are just going to be sick and overweight. And honestly it’s not your fault. You were just following the guidelines that have been set forth by the so-called experts in the field of health wellness and nutrition.

So again I want to tell you that if you have been doing everything that you have been told to do and you’re not losing weight it’s not your fault. You have just been given wrong information and wrong instructions and directions. Now in order to truly be healthy you have to get your  hormonal levels under control. And one of the easiest things that you can do is to control this by the foods that you are eating

One of the most important hormones in your body that will have an effect on whether you are fit and trim or overweight and fat and sick is insulin. Insulin is one of the most important hormones in your body. When your insulin levels are excessively high they put you into fat storage mode. Meaning everything that you eat is going to be stored his body fat.

This means that in order to stay fit trim and healthy you have to keep your insulin levels at a relatively normal level throughout the course of your day. And the way that you do this is to control the amount of foods that you eat that turn into sugar. And as you may have guessed the type of foods that turn into sugar are your bad starchy carbohydrates that are processed and man-made such as your bread, pasta, rice, pretzels, potato chips and all those other yummy snacks that we love to snack on.

Now of course I am a firm believer in eating good healthy food and that includes lots of vegetables, every color of vegetable and every type. Vegetables are a carbohydrate but they are nutritious healthy carbohydrates that are loaded with good nutrition and healthy fiber that will help to keep us healthy. And if we are healthy most of the time our weight will be controlled.

So for me the perfect diet would consist of lots of vegetables, a modest amount of good healthy protein, a small amount of good healthy fats and a little bit of fruit and your other starchy carbohydrates.

So you see that I am not totally against your starchy carbohydrates like bread and pasta it’s just that I believe that we should be eating much less of these types of food than we are eating in today’s society.

A few paragraphs up, I told you that hormones control your health wellness and the amount of weight fat etc. that you have on your body. And this is another key point because as we get older our amounts of hormones decrease in quantity over the period of time.

And this is the reason why most of us hit a certain age usually somewhere in the mid 30s and we start gaining weight every year. First we may start out just by gaining a couple pounds a year and then that increases to as much as 5 pounds or 10 pounds a year. Then we finally wake up and realize that we are 60 or 70 pounds overweight and we need to do something about it.

You see you when we were younger and we had an abundance of hormones; they helped burn that extra sugar out of our body. They helped keep the insulin at lower levels. But as we get older and our body’s natural hormones level decrease our body is not able to burn up that extra sugar like it did when we were younger.

This is why you are now gaining weight even though you are eating the same type of food, following the same diet plan and even exercising the same way as you did when you were much younger.

Losing weight and being fit and healthy just comes down to eating the right types of food in the proper portion sizes.

And please do not forget that calories do matter.

We have lots of people coming to us from other medical weight loss centers and they were told to eat a high-protein low-carb diet and that they could eat as much meat protein and cheese as they want.

But this is not healthy and it’s not true. Your body can only handle so much protein and process it properly. Excessive amounts of protein do you turn into sugar just like your bread and pasta.

I know some of you were probably reading this article and just shaking your heads in disbelief because if you would have been given this information long ago you would not be overweight now.

So now that you have the right information let’s get you on the right path. Let’s start developing healthy lifestyle habits. Little changes over the course of time that are going to add up to lots of pounds lost and a healthier and more fit you.

Trying to do all of these changes at once can be a little bit overwhelming so I advise you to start out slowly.

If your hormonal system is totally out of balance it’s always a good idea to work with a Weight Loss center. Especially one like ours where we have medical physicians that can assist you with the use of prescription weight-loss medication appetite suppressant medication.

The government has realized that obesity is a major health crisis in this country now. And it’s my belief that that is why the FDA has approved quite a few new weight-loss medications over the past several years.

In the past most weight loss pills were only meant to be taken for a short period of time but now we have newer weight-loss medications that are approved by the FDA for long-term usage.

So while some people may only need to be on the weight-loss medications for short period of time others may need to take them for the rest of their life because of hormonal issues. And that is why the pharmaceutical companies have spent billions of dollars in research and development of these drugs to help with this major health crisis. And that is why the FDA is now approving these weight-loss medications for long-term use.

Now there are certain qualifiers that have to be met in order for the physician to prescribe these medications for you. Some of them are your BMI, your height, your weight, your waist circumference, your pant size, your dress size, if you or family member have the following illnesses: diabetes, heart attack, stroke, cancer, high blood pressure, hypertension, hypothyroidism and sleep apnea – difficulty sleeping

The weight-loss medications to a great job of controlling the appetite and hopefully limiting your cravings but you still have to eat the right types of food to and that is why we spend quite a bit of time reviewing good healthy eating nutrition plans with our weight-loss patients. And getting some exercise – physical activity is also highly recommended.

If you need help with losing weight or just trying to improve your health and wellness give us a call and schedule a free weight loss consultation. Call 215-821-7336 and we will happy to schedule your free consultation.

adipexinphiladelphiabelviqinphiladeldphiabestphillydietdoctorsContraveinphiladelphiadietpillsinphiladelphiainexpensiveweightlosspillsinphiladelphiamedicallysupervisedweightlossinphiladelphiamedicalweightlossinphiladelphiaPhendimetrazineinphiladelphiaphentermineinphiladlephiaphillydietdoctorsqsymiainphiladelphiasafeweightlosinphiladelphiaSaxendainphiladelphiaTopamaxinphiladelphiaTopitamateinphiladelphiaweightlossinphiladelphiaweightlosspillsinphiladelphiaXenicalinphiladelphia
Read more
  • Published in diet doctors, Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Blast Fat Fast with These 5 Hot Bod Recipes

Thursday, 23 February 2017 by Dr. Michael Kenny

 

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

Losing weight in our program is so much more than just the best weight loss pills and appetite suppressant medications.

In our Philadelphia medical weight loss program and our Bucks County medical weight loss program a powerful combination of FDA approved weight loss medications, vitamin injections therapy and a healthy meal plan has helped many people lose weight and achieved her health and wellness goals.

Our program goes so far beyond this by teaching you how to eat properly and help to exercise properly to achieve your goals. We do this to empower you with all of the information that you need to lose weight and maintain your weight loss without having to take some type of weight loss medication for the rest of your life.

That’s why we put so much emphasis on healthy eating habits and simple exercise plans the for most people just is walking. That’s why we are constantly updating this blog with healthy recipes and meal plans each and every week.

So even though you may not have to take medication for the rest of your life you can always come back to this blog as a source of information for great recipes to help you maintain your weight loss and even for new information and studies that are constantly being done for weight loss, health and wellness

So with all that being said here are 5 great smoothie recipes that are loaded with great nutrition and will help your tummy and eliminate your cravings and hunger.

The Banana Veggie Smoothie Bomb

  • Spinach – 1 handful
  • kale – 1 handful
  • broccoli – 1 handful
  • banana – 1 small bananas
  • frozen blackberries – 1 cup
  • ice – 1 cup
  • one scoop a wakeupskinny protein powder
  • First blend the handful of broccoli, then add the spinach and kale and blend once again and then add your fruit and wakeupskinny protein powder. After that add the cup of ice and blend everything thoroughly.

Ashley’s Smoothie Recipe

  • 1 scoop a wakeupskinny protein powder
  • 1 handful spinach
  • 1 handful of kale
  • 1 handful of mixed greens
  • 1 banana
  • 1/2 cup of unsweetened almond milk
  • 1/2 cup of Greek yogurt
  • 1/2 cup of ice
  • First add your vegetables to the blender and blend and then add the fruit, unsweetened almond milk and yogurt and blend once again and after that add everything else and blend until it’s frosty creamy smooth. If you like this a bit sweeter or you can add 1 – 2 packet of Stevia.

Creamy Avocado Banana Smoothie

  • 1 scoop a wakeupskinny protein powder
  • 1 handful of kale
  • 1 handful of broccoli florets
  • 1 cup of Greek yogurt
  • 1/2 of a small avocado peeled
  • 1 banana
  • 1/2 cup of ice
  • Blend your kale, broccoli florets and avocado and then add the fruit, protein powder and the ice and blend until it’s nice and frosty creamy smooth.

Minty Apple Ginger Smoothie

  • one scoop a wakeupskinny protein powder
  • 2 handfuls of kale
  • 2 small apples – remove the core and the seeds
  • 1/4-inch piece of fresh ginger graded
  • 1/4 cup of fresh mint leaves chopped
  • combine all the ingredients into the blender and enjoy. If needed you can add 1 – 2 packet Stevia to make this a little bit more sweet.

Morning Breakfast Smoothie

  • 1 scoop a wakeupskinny protein powder
  • 1 handful of spinach
  • 1 handful of kale
  • 1 orange – peeled and seeded
  • 1 pair – cored and seeded
  • 1/4 – 1/2 cup of full fat Greek yogurt
  • 1 tablespoon of ground flax or Chia seeds
  • Combine everything into a blender and enjoy.

I hope you enjoy the smoothies as much as I do. They have been very helpful maintaining my weight loss over these past few years.

If you or someone you know needs help losing weight or improving overall health and wellness I invite you to call and schedule your free weight loss consultation. For your free weight loss consultation call us at 215-821-7336.

For maximum health and wellness when you are making the smoothies make sure that you are having at least 1 – 2 handfuls of vegetables, preferably green vegetables.

"Philadelphia Diet Doctor""Weight Loss Doctors in Philadelphia"diet pills Philadelphiamedical weight loss doctors Philadelphiamedical weight loss in philadelphiaweight loss in philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Drop Pounds Fast With These 4 Smoothie Recipes by Medical Weight Loss in Philadelphia

Monday, 20 February 2017 by Dr. Michael Kenny

medical weight loss in philadelphia weight loss pills diet pillsIn our Philadelphia medical most program we know that now is the time that everyone starts getting ready for those summer days at the beach. And this means that most of us are trying to lose weight and drop those pounds and inches so that we look good and feel good in our bathing suits.

That’s why in this article I am going to give you four great smoothie recipes that will help you lose weight fast. When you combine these smoothies with everything that we give you in our medical weight loss program (proper rapid weight loss diet plan, exercise plan and FDA approved medical weight loss pills and appetite suppressant medications and our vitamin shots) you should be ready for the beach this summer.

If you would like more information on our medical weight loss program or even better schedule your free weight loss consultation call us at 215-821-7336 and our friendly staff would be happy to schedule you.

Today I’m going to give you some great recipes and they are for a creamy chocolate smoothie, a tropical paradise movie, a green monster smoothie and an apple a day smoothie.

So here are the recipe, Enjoy!!

Creamy Chocolate Smoothie

  • unsweetened almond milk – 1 cup
  • banana – 1 frozen banana
  • small avocado – one half of a small avocado peeled and pitted
  • honey – 1 tablespoon
  • unsweetened cocoa powder – 1 tablespoon
  • Combine the unsweetened almond milk, frozen banana, half of a small avocado, honey and unsweetened cocoa powder in a blender and blend until it’s creamy smooth. This recipe makes one smoothie.

Tropical Paradise Smoothie

  • one small orange – peeled with the seas removed
  • one small banana
  • flaked coconut – 2 tablespoons
  • 1/2 cup of unsweetened yogurt
  • 1/4 cup of ice cubes
  • optional – 1/4 cup of pineapple chunks
  • Combine everything into a blender and enjoy. This recipe makes 1 – 2 servings.

Green Monster Smoothie

  • Seedless green grapes – 1 cup
  • Kiwi – 1 small Kiwi peeled
  • 1/2 avocado – pitted and peeled
  • combine the seedless grapes, kiwi and half avocado into a blender and blend until it’s creamy smooth. This recipe makes one large serving.

An Apple a Day Smoothie

  • 1 Apple – preferably a Granny Smith apple cut into quarters and seeded
  • 1 cup of baby spinach
  • 1/2 cup of avocado – pitted and peeled
  • almond butter – 1 teaspoon
  • grated fresh ginger – 1/2 teaspoon
  • 1/2 – 1 cup of ice cubes
  • Combine your apple, baby spinach, avocado, almond butter and ginger into a blender and blend until it’s creamy smooth, then enjoy. This recipe makes one large serving.

So there you have it four fantastic smoothie recipes that will satisfy your taste buds, help control your appetite and cravings and help you lose weight safely.

If you, a friend or loved one would like help in losing weight I invite you to call us now and schedule a free weight loss consultation. Call us now at 215-821-7336.

medical weight loss in philadelphiaphiladelphia weight loss doctors
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Fat Burning Italian Food Recipes by Medical Weight Loss Philadelphia

Sunday, 29 January 2017 by Dr. Michael Kenny

medical-weight-loss-in-philadelphia-weight-loss-pills-diet-pillsIn our Philadelphia and Bucks County medical weight loss centers our goal is to help you lose weight and keep it off. And we do this by providing you with the finest FDA approved weight loss pills, diet pills, appetite suppressant medications, vitamin B-12 injections therapy and delicious meal plans that are designed to satisfy your cravings and help eliminate your hunger.

And these meal plans taste good too. So, if you are looking to lose weight and keep it off, while still eating delicious food I invite you to call us and schedule your free medical weight loss consultation at our Philadelphia medical weight loss center or our Bucks County medical weight loss center. Call us now at 215-821-7336 and schedule your free weight loss consultation.

If you are one of our weight loss patients you know that I believe that food is meant to be enjoyed. Growing up in my family everything that we did, every celebration every event was always celebrated with food, and lots of. In a sense, food was a celebration of life.

And some of my happiest from childhood are of sitting together with my great-grandparents, grandparents, parents, my brother and sister, and uncles and cousins at my great-grandmothers dining room table where we feasted upon ravioli, lasagna, baked zitti, gnocchi and desserts like ricotta filled cannolis and cream puffs. Yes, you may have guessed, that I grew up in a large Italian family! And like most Italian families most interactions with one another took place at the kitchen table or dining room table enjoying good food and each other.

That is why in our weight loss program we make a point of giving you lots of recipes of wholesome food that we all grew up eating but our versions of these recipes will have lower calories and lower carbohydrates. Making them weight loss friendly. But they taste so good you won’t believe there diet food.

So here are two great recipes; one is for a low carbohydrate version of my grandmother’s rotolo and the other is for a low-carb recipe for lasagna that is quick and easy to make.

This is a family recipe that my great-grandmother Virginia has handed down to my wife. My wife has changed the recipe a bit, to make it more diabetic friendly, but it tastes just as good if not better than Great[grandma’s recipe.

Rotolo – Verdi Style

  • Ingredients for the Filling:
  • ricotta cheese – 12 ounces 1 1/2 cups
  • Parmesan cheese, approximately the 4 ounces of grated Parmesan cheese
  • finely chopped fresh oregano – 1/2 cup
  • finely chopped – fresh parsley – 1/2 cup
  • egg – 1 large egg
  • minced raw garlic – 3 cloves
  • Sea salt – 1/2 teaspoon
  • nutmeg – 1/8 teaspoon of ground nutmeg
  • black pepper – 1/8 teaspoon of ground black pepper
  • Additional Ingredients:
  • Roasted or delimeat chicken breast that you can get from your supermarket – cut into strips that are 1.5 inches wide and 6 inches long. You should have about 24 slices of meat.
  • 2 cups of tomato sauce
  • shredded mozzarella cheese – approximately the 1/2 cup
  • some additional Parmesan cheese to serve over top when everything is finished cooking.

First preheat your oven to 300°F. Combine all of the ingredients together except for the chicken breast tomato sauce and the extra 1/2 cup of shredded mozzarella and Parmesan cheese. Make sure that all of the ingredients are mixed nicely.

Then take your strips of chicken and place them on your counter and take 1/3 cup of the mixture of all your ingredients in place it on to your strip of chicken. Then start rolling it up and place it with the seam side down. Do this with the rest of your chicken strips. After that take 1 cup of your tomato sauce and pour it into the bottom of a cast iron skillet approximately 12 inches or you can use any other type of ovenproof skillet or pan.

Then take your chicken rolls and put them in the pan with them laying on their side. Take all of your roles of meat and place them in the pan so they fit very snugly. Make sure that your filling is facing upward. Next take the remaining 1 cup of tomato sauce and pour it over top. You can now put this in your oven and let it bake for approximately the 20 minutes or until the cheese is melted completely.

When it is done take it out of the oven and you can now sprinkle your mozzarella generously over top. Place it back in the oven for about another 10 minutes or so or until the cheese is melted once again. After that take it out of the oven and let it stand for at least a good 15 minutes before serving. And of course you can top it with the extra Parmesan cheese if you would like.

This recipe makes 12 servings each of them has about 386 calories, 61 grams of protein and 5 grams of carbohydrates.

Lasagna – Low Carb Style Roll Ups

  • Ingredients:
  • approximately three-quarter pound and you can use either oven roasted chicken breast from the deli counter – approximately 16 slices or you can use sliced oven roasted turkey from your deli counter. Make sure that the slices of meat are approximately 1/8 inch and you want to have 16 slices.
  • To make the filling you will need:
  • ricotta cheese – 1 cup
  • egg – 1 large egg
  • Parmesan cheese – approximately 1/3 cup of grated Parmesan cheese
  • mozzarella cheese – 1 1/2 cups of shredded mozzarella cheese
  • Additional Ingredients
  • tomatoes – three medium-sized tomatoes – sliced thin
  • fresh basil leaves
  • 2 cups of tomato sauce – meat sauce or marinara sauce

As always first we have to preheat your oven. Preheat the oven to 325°F. Place your turkey on a large sheet of parchment paper. To make the filling take a large bowl and mix together the eggs ricotta cheese until their mixed nicely and then stir in the mozzarella cheese and the Parmesan cheese.

After you have made the filling take about 1/4 cup of it and place it on top of one of your meat slices and spread it out evenly. Do this with the remaining slices of meat. Take about 3 slices of tomato and place them over top of your filling on each of the slices of meat. Next take some of your basil and place it on top of your tomatoes.

After that rollup each slice of meat and place them, seam side down, a and a baking dish that is approximately 8 inches. When you have all of the strips of meat rolled up with the mixture tomato and basil inside and placed in your baking pans top each one of them with the marinara sauce. I like to use about 2 – 3 tablespoons of the sauce.

Now we are finally ready to place it in the oven and bake it for about 25 minutes or so or until the cheese is melted. This recipe makes four servings each of them has 467 cal, 50 grams of protein and 9 g of carbohydrates.

I truly do hope you enjoy these recipes and if you would like help losing weight I invite you to call us and schedule your free consultation. Call us at 215-821-7336 and schedule your free weight loss consultation now.

"Weight Loss Doctors in Philadelphia"diet pils in philadelphiamedical weight loss in philadelphiaMedical Weight Loss Philadelphiaphentermine in Philadelphiaweight loss pills in philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Lose Weight Fast and Keep It Off with Medical Weight Loss in Philadelphia

Monday, 16 January 2017 by Dr. Michael Kenny
medical weight loss in philadelphia diet doctors weight loss pills appetite suppressant medications phentermine in philadelphia

medical weight loss in philadelphia diet doctors weight loss pills appetite suppressant medications phentermine in philadelphia

If you want to lose weight fast and keep it off call our weight loss program is for you. In our medically proven weight-loss program we use the finest FDA approved appetite suppressant medications weight loss and diet pills vitamin B12 diet injection therapy and develop a simple nutritional weight loss meal plan that allows you to eat real food and still lose weight.

So if you are looking for a medically supervised clinical weight loss program I invite you to call and schedule your free weight loss consultation. Call us now at 215-821-7336 and Lisa will schedule you for your free weight loss consultation.

In addition to high quality FDA approved appetite suppressants we give you meal plans and recipes to help you lose weight and keep it off.

Here are 2 great recipes for you. A great Parfait of Berries and Cream and awesome chicken wings that are great for Sunday football games.

Elyse’s Favorite Parfait – Berries and Cream – Paleo Recipe

  • Heavy cream– whipping cream–1/2 cup
  • Cocoa powder–1 tablespoon
  • Vanilla extract– 1 teaspoon
  • Almonds – 6 crushed almonds
  • Walnuts– 6 crushed walnuts
  • Strawberries– 3 strawberries diced
  • Raspberries – 1/3 cup
  • BlackBerries– 1/3 third cup
  • Blueberries– 10 blueberries
  • Chia seeds– 1/2 tablespoons
  • Flax seeds – 1/2 tablespoons of ground flaxseed
  • Cinnamon – 1 teaspoon of cinnamon

First put your heavy whipping cream in a large bowl and mix in the vanilla extract and cocoa powder.

Then using a mixer, mix the cream – (whip it) – for about 3 minutes. If you like, you can place this in the freezer for about 40 minutes for a nice cold snack. Then mix the nuts and berries into the cream. After that, mix in the ground flaxseed, Chia seeds and then sprinkle the cinnamon over top if you like.

This recipe makes two servings. I like this recipe because the nuts make it crunchy, the fruit makes it sweet (but not too sweet)  and the full fat heavy cream makes it even more enjoyable. This is great for breakfast and it’s also really good for a snack during the day. The nuts and cream make it hearty enough for the cold winter months and it’s also cool and refreshing for those hot summer days. It’s a perfect recipe.

Football Sunday Wings

  • Chicken wings – 2 pounds
  • Himalayan salt – 1 tablespoon
  • Ground black pepper – 1 teaspoon
  • Baking powder – 1 tablespoon
  • Smoked paprika – 1 teaspoon
  • Garlic salt – 1 teaspoon
  • Coconut oil – 2 tablespoons
  • Optional- hot sauce- 2 tablespoons

Mix together the pepper, salt, baking powder, paprika and garlic salt. Take a large plastic Ziploc bag and add the chicken wings along with your mixture of spices. Close it and then shake the bag well to coat all of the wings with the seasoning. Preheat a large pan over medium heat and melt the coconut oil. Next check your chicken wings and place them in the skillet and then place a cover over top of the skillet and cook this for about 10–12 minutes. Then flip the wings over and let them cook for another 10–12 minutes until they are nice and brown. When they are finished cooking remove them from the heat and cool down for a little bit. You could serve them with hot sauce if you like.

I hope you enjoy these recipes and if you need help losing weight just call us at 215-821-7336 and schedule your free weight loss consultation.

"Medical Weight Loss clinic Philadelphia""Philadelphia Diet Doctor"appetite suppressant medications in philadelphiaMedical Weight Loss Philadelphiaphiladelphia diet doctorsphiladelphia medical weight lossweight loss pills philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Hunger Killing Belly Flattening Super Shakes by Medical Weight Loss in Philadelphia

Tuesday, 03 January 2017 by Dr. Michael Kenny
medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

If you are trying to lose weight and would like more information on our medically supervised weight loss program call us now and Lisa will schedule you for your free weight loss consultation. Call us at 215-821-7336 and schedule your free consultation now. In addition to using FDA approved medical weight loss pills appetite suppressant medications and Vitamin B12 injection therapy we also coach you in the correct type of nutrition diet eating plan to help you safely lose as much weight as you can and as fast as you can. We will also coach you in the correct type of exercise plan for maximal fat loss depending on your age, overall health and level of physical fitness. And every week we add more delicious recipes to our blog here so that you never get bored eating just plain old diet food.

So for more information on our weight loss plan call us now at 215-821-7336 and schedule your free weight loss consultation.

And here are the delicious shakes I promised:

Cravings Killer Smoothie

  • Ingredients:
  • banana -1 medium sized banana
  • avocado – 1/2 of a small to medium size avocado
  • spinach –  1 to 2 cups of spinach or kale
  • coconut oil – 1 to 2 tablespoons
  • sugar free coconut milk – 1/4 cup
  • water – 1 cup
  • cinnamon – 1 teaspoon

All of the good healthy fats help control your appetite and cravings and the cinnamon helps to control your blood sugar levels and that is what controls controls you craving sugar.

Vanilla & Berry Tea Latte for Two

  • Ingredients:
  • 2 to 3 cups of steeped hot tea
  • 1 to 2 teaspoons of vanilla extract
  • 2 to 3 tablespoons of butter – grass fed butter
  • Berries – ½ cup of any berry
  • Salt – a dash of sea salt

Put all of the ingredients into a blender. Blend and enjoy. This serves 2 people.

Mega Immune Booster Tea

  • ½ can of sugar free coconut milk (you can use full fat)
  • Dried turmeric – 1 teaspoon
  • Honey – 1 teaspoon
  • Ginger – 1 teaspoon of grated ginger
  • Butter – 1 tablespoon or 1 teaspoon of collagen powder

Add all of the ingredients into a pan and continuously stir until it is warm and totally mixed together

Carrot Cake For Two Super Smoothie

  • Ingredients:
  • 2 to 3 carrots – chopped
  • Banana – 1
  • Avocado -1
  • Unsweetened coconut milk – 1 can of full fat coconut milk
  • Ginger – 1 teaspoon
  • Cinnamon – 1 teaspoon
  • Collagen powder- 2 tablespoons
  • Gelatin powder – 2 tablespoons

Add all of the ingredients, except for the gelatin and collagen powders into a blender and blend it all together. Then add the collagen and gelatin powders and blend at the lowest speed. And Enjoy! This serves 2 people.

I hope you enjoy these recipes.

Call us now at 215-821-7336  for your free weight loss consultation.

adipex in philadelphiacontrave in philadelphiamedical weight loss in philadelphiaqsymia in philadelphiaweight loss in philadelphiaweight loss pills in philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Cookies and Cream Zero Belly Fat Recipe by Medical Weight Loss in Philadelphia

Monday, 26 December 2016 by Dr. Michael Kenny
medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

medical weight loss in philadlephia weight loss diet doctors where can i get phentermine in philadelphia

Hi everyone this is Dr. Kenny. I hope everyone is having a wonderful holiday season. In this blog post I’m going to give you an awesome recipe for a mug cake. It’s another twist on the recipe for a cookies and cream cake. This recipe is great because it’s loaded with cookie chunks and it’s super simple and quick to make. It has lots of good healthy protein, fiber and it’s also gluten-free,  dairy free and paleo friendly.

During the holiday season of November and December statistics tell us that people can gain anywhere from 10 pounds and is much as 20 pounds during these two months.

Between family dinners, get-togethers and celebrations with friends and family and even people bringing lots of delicious but fattening goodies into the workplace it’s very difficult to maintain any type of healthy eating program let alone a weight loss eating nutrition program.

So that is why during these next few weeks I’m going to step up my game and try to add at least three new recipes to our website. Some of these recipes may be low carbohydrate and low sugar and others will be low-calorie versions of foods that we love to eat. I am also going to try to add some healthy ingredients to foods that are normally loaded with sugar and lots of calories.

And that’s exactly what I’m doing with this recipe for this cooking cream mug cake. Usually this type of recipe has nothing but lots and lots of sugar in calories and provide no nutritional value. But by using coconut flour and almond flour we are adding good healthy fiber and significantly decreasing the amount of sugar that we would normally be eating if this recipe was made from good old white processed flour. And because we are using Stevia or swerve instead of regular sugar we are decreasing the amount of sugar that would normally be in this type of recipe. By using unsweetened almond milk or coconut milk we are also increasing its nutritional value and eliminating lots of allergic reactions that are associated with normal regular dairy products such as milk.

If you want to make this recipe totally good for you you should probably decrease the amount of optional ingredients like in the unsweetened sugar-free chocolate or vanilla chips. I just added these in their because my son Noah saw me making this recipe this morning and he wanted to add some additional flavor to the recipe. If you like the addition of the unsweetened/sugar free chocolate or vanilla chips make sure you tell Noah when you see him working in the office this summer.

If you are not one of our Philadelphia medical weight loss patients or Bucks County medical weight loss patients and would like information on our weight loss program, I invite you to call us and schedule your free medical weight loss consultation. Call us now at 215-821-7336 and Lisa will be more than happy to schedule your free consultation.

Here is the recipe:

Creamy Cookie Cake Recipe – Low Carb

  • Ingredients
  • coconut flour – 1&1/2 TBSPS
  • almond flour – 1 TBSP
  • sea salt – just a dash
  • baking powder – 1/2 TSP
  • Swerve or Stevia – 1 TBSP
  • Paleo cookie – any kind of 1-3 paleo cookies
  • egg – 1 large egg
  • unsweetened almond or coconut milk any flavor – 1/4 cup
  • 1/2 tsp vanilla extract – 1/2 TSP
  • Optional – unsweetened/sugar free chocolate or vanilla chips – 1 TBSP

Instructions:   In an oversized mug or even a bowl mix together your coconut flour, salt, baking powder, almond flour, swerve or Stevia and your cookie.

Take another bowl and mix together your unsweetened coconut milk or almond milk, eggs and vanilla extract. Make sure that you blend this well together. Now that you have your dry ingredients in one bowl and your wet ingredients in another were going to combined the two of them and stir everything until it’s mixed together nicely.

Next get an over-sized mug or even better a nice sized ball and for everything into it. Place it in the microwave and cook it for about 45 seconds. Then take it out of the microwave and check it. At this point you can add your chocolate chips and place it back to the microwave and cook it for as long as it needs to cook everything thoroughly.

This could possibly take another minute or so. Total microwaving time is anywhere from 1 – 2 minutes. But again depending upon the strength of your microwave it might be a little bit more or even a little bit less time. When it’s thoroughly cooked take it out of the microwave let it cool down quite a bit before attempting to eat it. This recipe makes one serving.

So there you have it another fantastic low-carb recipe that not only taste good but it’s also very good for your waistline.

If you would like more information on our medical weight loss program again I invite you to call us at 215-821-7336 and Lisa will be happy to schedule your totally free weight loss consultation. In your free weight loss consultation we will review the various type of weight loss programs and services that we offer and review your personal health and physical decision the determine which of our weight loss program would be the best for you in the safest.

Our goal is to help you lose weight safely and as quickly as possible and also improve your overall health and wellness.

diet pills in philadelphiamedical weight loss in philadelphiaphentermine in Philadelphiaphiladelphia weight loss diet doctorsweight loss in philadelphiaweight loss pills in philadlephia
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

2 Holiday Dessert Recipes To Lose Weight by Medical Weight Loss in Philadelphia

Saturday, 24 December 2016 by Dr. Michael Kenny

medical-weight-loss-in-philadelphia-weight-loss-pills-diet-pillsHappy holidays everyone! During this holiday season it’s almost impossible not to enjoy the delicious feasts, cakes and desserts with family and friends.  So to help  you maintain your weight loss during this holiday season I’m going to give you two phenomenal recipes that are low-carb and low in sugar.

The recipes are for my favorite Oreo and cream cheesecake and one of my favorite cookie recipes.  And please remember that In our Philadelphia Medical Weight Loss Program and our Bucks County Medical Weight Loss Program our goal is to have you enjoying lots of good healthy delicious food  while you are losing weight and improving your health.  If you are new to our weight loss program and would like more information just call us and schedule your free medical what was consultation at 215-321-7336 and Lisa will set up your free consultation for you. Once again happy holidays and here are those great recipes I told you about.

If you need help achieving your weight loss goals I invite you to call us and schedule your free medical weight loss consultation at 215-821-7336. Call now and Lisa will be glad to schedule your free consultation for you.

Biscotti Low Carb & Gluten Free

  • Ingredients:
  • 1 large egg
  • Swerve – ⅓ cup
  • stevia extract – ¼ tsp
  • butter – ¼ cup
  • vanilla extract, sugar free – ½ tsp
  • almond flour – 1 and ¾ cups
  • xanthan gum – ¼ tsp
  • unsweetened cocoa – ½ cup
  • baking soda – ½ tsp
  • salt – ¼ tsp
  • cinnamon – 1 tsp
  • Optional items include chopped nuts and sugar free chocolate chips

Instructions:

First we should preheat our oven to 325 F. Then in a bowl, stir or blend together the eggs, butter, vanilla extract, swerve and stevia. In another bowl stir together the remaining ingredients until they are mixed nicely. Then combine the ingredients of both bowls and you can add the sugar free chocolate chips and the nuts if you would like to.

Mold this into a nice big dough ball. Next grease a cookie sheet and spread the dough out and form your typical biscotti. Next we bake this for about 25 minutes, just until it’s slightly browned. Take it out of the oven and decrease the temperature to 275 F. Allow the biscotti to cool down for about 14 minutes and cut it into strips that are approximately one half inch wide. Then put the individual biscotti on their side onto the cookie sheet and bake them for another 25 – 30 minutes, or for as long as to takes for them to cook to a nice crispness.

This recipes makes about 15 biscotti and each has approx 2 grams of carbohydrates.

Oreo Cookies and Cream Cheesecake Low Carb

  • Ingredients:
  • Low carbohydrate chocolate cookies – one pound (the above cookie recipe is perfect for this)
  • butter – ½ cup
  • cream cheese – 8 ounces
  • Swerve – ⅔ cup
  • stevia extract – ½ tsp
  • heavy cream – 1 cup
  • eggs – 6 large
  • coconut flour – 2 tbsps
  • vanilla extract – sugar free – 2 tbsps

This is a really fantastic recipe. To start just take a 9 inch spring form pan and grease it. Then preheat your oven to 350°F. Next break up your cookies into very tiny crumbs. You can use your hands or just use your food processor to do this. Divide your cookie crumbs into two separate bowls and stir one half into your melted butter. You are going to take this butter and cookie crumb mixture and line the bottom of your springform pan with it.  

After doing this place the pan in your refrigerator. Next you want to blend together your swerve, whipping cream and cream cheese. Make sure that you use a large bowl for this.  When it’s nice and smooth you can add the vanilla, coconut flour and eggs and stir everything until it’s creamy smooth. Then take your springform pan out of the refrigerator and pour half of your cream cheese mixture over top of the crust. Then take the other half of your cookie crumbs and pour that over top and then just pour the rest of the creamy mixture over top of that. Next place this in the oven and let it bake for about an hour or so. You want to bake it for as long as it takes for the center to become very firm.

Finally take the cheesecake out of the oven and let it cool down. Personally I like to let it cool down for at least one hour and then you can remove it from the pan. For the best tasting cheesecake I like to leave it in the refrigerator until the next day. This is one of those recipes where there cake will actually taste better the next day.  This recipe makes 12 servings each of them having about 3 – 4 grams of carbohydrates.

If you need help achieving your weight loss goals I invite you to call us and schedule your free medical weight loss consultation at 215-821-7336. Call now and Lisa will be glad to schedule your free consultation for you. Happy holidays and I hope you enjoy these recipes is much as I do.

39.9500° N 75.1667° Wdiet pills Philadelphiadoctors prescribe phentermine Philadelphiamedical weight loss bucks county pamedical weight loss doctors Philadelphiaphentermine in Philadelphiaphiladelphiaphiladelphia diet doctorsphiladelphia weight loss doctorsvitamin B12 injections Philadelphiaweight loss philadelphiaweight loss pills philadelphiaweight loss programs Philadelphia
Read more
  • Published in Diet Doctors in Bucks County, Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Sweet Treats To Blast Away Fat and Eliminate Hunger by Medical Weight Loss Philadelphia

Saturday, 12 November 2016 by Dr. Michael Kenny
medical weight loss philadelphia diet doctors

medical weight loss philadelphia diet doctors

Today I am going to share with you 3 great low calorie recipes that are under 200 calories per serving. If you have never been to our weight loss center call us and schedule your free weight loss consultation. Call us at 215-821-7336.

The recipes are for Apple Raisin Muffins, Pumpkin Muffins and Banana Pecan Waffles.

Our son Noah will soon be home from College for the holiday break and my wife is already buying the ingredients for these recipes because they are his favorites. Your family will not believe that these recipes are for diet food so let me know how you and your family enjoyed them.

Here are the recipes:

*Apple-Raisin Muffins

  • Ingredients:
  • All-purpose flour- 2 cups
  • Packed dark-brown sugar- ½ cup
  • Baking powder- 1 tsp
  • Baking soda- ½ tsp
  • Ground cinnamon- ½ tsp
  • Salt- ½ tsp
  • Buttermilk- ¾ cup
  • Unsweetened applesauce- ½ cup
  • Large egg whites- 2
  • Canola oil- 2 tbs
  • Chopped peeled apple- 1 cup
  • Dark seedless raisins- ⅓ cup

First set oven to 400 degrees. Spray 12 standard-size muffin-pan cups with cooking spray. In a large bowl mix together flour, brown sugar, baking powder, baking soda, cinnamon and salt. Form a well in the center. In a small bowl mix together buttermilk, applesauce, egg whites and canola oil. Add buttermilk mixture into well of flour mixture. Mix until moistened (do not overmix). Fold in apple and raisins. Add even amounts to each muffin cup. Bake for 25 minutes. Let cool on rack. Enjoy!

Nutrient value per muffin: 161 calories, 3 g protein, 1 g fiber, 3 g fat, 32 g carbohydrate, 221 mg sodium, 1 mg cholesterol

*Pumpkin Lovers Muffins

  • Ingredients:
  • Almond flour- 2 cup
  • Packed light-brown sugar- ¾ cup
  • Baking powder- 1 tbs
  • Ground cinnamon- 1 tsp
  • Ground ginger- 1 tsp
  • Salt- ¾ tsp
  • Ground allspice- ¼ tsp
  • Unsalted butter (cut into pieces,chilled)- 3 tbs
  • Liquid egg substitute- ¼ cup
  • Canned solid-pack pumpkin puree (not pie filling)- ¾ cup & 2 tbs
  • Nonfat milk- ⅔ cup
  • Vanilla- 1 tsp
  • Chopped pecans- 2 tbs

Preheat oven to 375 degrees. Use cooking spray on 12 standard-size muffin-pan cups and muffin-pan top. In a large bowl, mix together the brown sugar, allspice, ginger, cinnamon, salt, baking powder and flour. With 2 knives, if used as scissors you can cut butter until it appears as fine crumbs. Now in a small bowl, beat together egg substitute, pumpkin, milk, and vanilla until mixed. Add batter to muffin cups equally. Sprinkle pecans on top and bake for 25 minutes. Place muffins on rack to let cool slightly then enjoy!

Nutrient value per muffin: 179 calories, 4 g fat, 2 g saturated, 4 g protein, 32 g carbohydrate, 2 g fiber, 291 mg sodium, 8 mg cholesterol

*Banana-Pecan Waffles

  • Ingredients:
  • All-purpose flour- 1 ¾ cup
  • Sugar- 1 tbs
  • Baking powder- ½ tsp
  • Baking soda- ½ tsp
  • Ground cinnamon- ½ tsp
  • Salt- ¼ tsp
  • Mashed banana (2 small)- ¾ cup
  • Large egg whites- 2
  • Large whole egg- 1
  • Vegetable oil- 1 tbs
  • Buttermilk- 1 cup
  • Vanilla extract- 1 tsp
  • Pecans (toasted,finely chopped)- ¼ cup

Toppings (optional): Butter, sugar free maple syrup, sliced bananas, chopped pecans.

Start by heating a nonstick standard waffle iron. Now in a large bowl mix together flour, sugar, baking powder, baking soda, cinnamon, and salt. In a medium-sized bowl mix together banana, egg whites, whole eggs, oil, buttermilk, vanilla, and pecans. Create well in center of flour mixture, placing banana mixture inside. Quickly stir until flour mixture is moistened. Spray waffle iron with cooking spray, then add ⅓ cup of batter. Cook as instructions tell you. Add toppings you desire and enjoy!

Nutrient value per waffle: 193 calories, 6 g fat, 6 g protein, 30 g carbohydrate, 2 g fiber, 230 mg sodium, 28 mg cholesterol

Please come back to this blog section next week because every week we add more great recipes that are keys to losing weight and improving overall health and wellness.

*Source These recipes were taken from Eat what you love and lose by Peggy Katalinich. It’s a great cookbook and has lots of great low calorie recipes.

Diet Doctors in PhiladelphiaMedicalWeight LossMedical Weight Loss Philadelphiaphiladelphia diet doctorsweight loss philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments

Philadelphia Diet Doctor’s Recipes To Fill You Up and Slim You Down

Saturday, 01 October 2016 by Dr. Michael Kenny
Medical weight loss Philadelphia,weight loss Philadelphia,phentermine in Philadelphia,Philadelphia weight loss doctors,Philadelphia diet doctors,weight loss programs Philadelphia,medical weight loss doctors Philadelphia,weight loss pills Philadelphia,diet pills Philadelphia,vitamin B12 injections Philadelphia,doctors prescribe phentermine Philadelphia,medical weight loss Bucks County PA,39.9500° N 75.1667° W,

Medical weight loss Philadelphia,weight loss Philadelphia,phentermine in Philadelphia,Philadelphia weight loss doctors,Philadelphia diet doctors,weight loss programs Philadelphia,medical weight loss doctors Philadelphia,weight loss pills Philadelphia,diet pills Philadelphia,vitamin B12 injections Philadelphia,doctors prescribe phentermine Philadelphia,medical weight loss Bucks County PA,39.9500° N 75.1667° W,

We all know that our weight loss pills, appetite suppressant medications and Vitamin B12 injections help reduce your appetite and cravings and that when combined with our sensible eating plans our patients have loss as much as 2-5 pounds a week.

If you would like more information on our medical weight loss program just call us and we will answer all your questions and then you can schedule your free weight loss consultation. Call us at 215-821-7336

Here are 2 more great recipes under 200 calories to help you lose weight.

 

 

Low-Carb Pancakes and Syrup*

This is another one of my favorite recipes. It takes about 10 minutes to prepare everything and then of course you have to add the cooking time for cooking each of the pancakes. This recipe makes 12 pancakes and one serving size is considered three pancakes. Try to make the pancakes the size of about 5 inches.

  • Ingredients:
  • 3 large eggs – separate the yellow from the white
  • protein powder – 2 tablespoons of either egg white protein or any other type of protein powder that you like. Just make sure that it does not contain a lot of sugar and carbohydrates. That’s why I prefer egg white protein because it’s very low in carbs and in sugar.
  • 1 teaspoon of vanilla extract – you could really use any flavor that you prefer
  • Stevia or swerve – 1 teaspoon
  • Coconut oil or organic respite voter – we use this to coat our pan
  • 1/2 cup of our delicious brown butter syrup – for pouring over top of our pancakes

We begin by whipping the egg whites in a bowl for several minutes until they become very stiff. After that blend in the yolks, vanilla extract, Stevia and your protein powder.

Heat the coconut oil or the unsalted butter over top a medium – high heat then when it’s hot take 1/4 cup of the batter and pour it into your pan. (When my wife does this the pancakes always seem to be in perfect shape but for some reason when I do it I need to use a utensil to make it into an almost perfect circle.)

Then just fry the pancake until it’s a golden brown on both sides. This usually takes about 2 minutes per side. After that remove the pancake from the heat and set it aside on a plate and cover it to keep it nice and warm. Then just repeat this process until there is no more batter left. I usually need to add a bit more butter or coconut oil between cooking each pancake.

When you have cooked all of the batter just place the pancakes on individual serving plates and pour the syrup over top. Remember a serving size is three pancakes and each serving has approximately 175 cal, 13 g of fat, 8 g of protein, 0.6 g of carbohydrates in 0 g of fiber.

Brown Butter Syrup*

This is the recipe for the syrup to pour over top of your pancakes or anything else that  you would like to use syrup with. It only takes about one minute to mix everything together and then it takes about another five minutes for it to cook. This recipe makes one and a half cups of syrup and usually 2 tablespoons are considered a serving size. Each serving has approximately 75 cal, 8.4 g of fat, 0.2 g of protein 0.2 g of carbohydrates in 0 g of fiber.

  • Ingredients:
  • unsalted butter – 1 stick
  • 1/2 cup of swerve – you can use any others sugar substitute for this recipe, but I prefer to use swerve. It tastes just like real sugar and it doesn’t have that aftertaste that most other products have. Also,  if you consume a large quantity of some of the other sugar substitutes like xylitol   you may experience some stomach upset (and possibly diarrhea).
  • Cream cheese – 1 ounce
  • unsweetened almond milk or coconut milk – 1/2 cup
  • 1 teaspoon of maple extract
  • 1/4 teaspoon of sea salt

First we take a large saucepan and heat the butter over high heat, stirring it every few seconds.  The butter will start to foam up towards the top of the pan and it will then fall back down. You will start to see quite a few brown flecks and that is when you should remove it from the heat.

Remove the pan from the heat and stir in the swerve until it’s nice and smooth.  At this point you can mix in the cream cheese and stir until it’s smooth and then stir in the almond milk, maple extract and the salt.

Now set the pan aside and let it cool down a bit and then pour the mixture into a glass jar. It can stay fresh in the refrigerator for 2 weeks. Now, because of the ingredients, it will become thick while it is in the refrigerator. So when you are ready to use it you can just reheat it in a microwave or by placing it in a pan and heating it over a flame on your stove-top.

I hope you enjoy these recipes and if you need help losing weight call us and schedule your free medical weight loss consultation. Call 215-821-7336 and schedule your consultation now.

*Recipes are from the ketogenic cook book by jimmy Moore and Maria Emmerich. It should be part of your cooking library.

39.9500° N 75.1667° Wdiet pills Philadelphiadoctors prescribe phentermine Philadelphiamedical weight loss bucks county pamedical weight loss doctors PhiladelphiaMedical Weight Loss Philadelphiaphentermine in Philadelphiaphiladelphia diet doctorsphiladelphia weight loss doctorsvitamin B12 injections Philadelphiaweight loss philadelphiaweight loss pills philadelphiaweight loss programs Philadelphia
Read more
  • Published in Diet Doctors in Philadelphia, Medical Weight Loss, Medical Weight Loss in Philadelphia PA, Medical Weight Loss Philadelphia, Weight Loss, weight loss philadelphia
No Comments
  • 3
  • 4
  • 5
  • 6
  • 7
  • 8
  • 9

Wake Up Skinny

Phone Number

(215) 821-7336

Philadelphia Location

7439 Frankford Ave.
Philadelphia, PA 19136

Bucks County Location

1201 Buck Rd.
Suite 203
Feasterville, PA 19053

Lehigh County Location

163 N. Commerce Way
Bethlehem, PA 18017
TOP